PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000167208
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 180aa    MW: 20752.6 Da    PI: 8.2127
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000167208genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.92e-53251512128
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 
                    +pGfrFhPtdeel+++yL+ kv + ++     i+evd++++ePw+Lp  +k +e+ewyfFs rd+ky+tg r+nrat +gyWkatgkd++v+s+ +
  MDP0000167208  25 QPGFRFHPTDEELITFYLASKVYNGSFCG-VRIAEVDLNRCEPWELPDVAKMGEREWYFFSLRDRKYPTGMRTNRATGAGYWKATGKDRQVFSAsT 119
                    69************************777.45***************8888899**************************************9878 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    g+l g+kktLvfykgrap+g+kt+Wvmheyrl
  MDP0000167208 120 GALLGMKKTLVFYKGRAPRGHKTKWVMHEYRL 151
                    889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-5721156IPR003441NAC domain
PROSITE profilePS5100553.33724167IPR003441NAC domain
PfamPF023654.0E-2826151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MLGIGMEEIM SELMSGEDEN GQGFQPGFRF HPTDEELITF YLASKVYNGS FCGVRIAEVD  60
LNRCEPWELP DVAKMGEREW YFFSLRDRKY PTGMRTNRAT GAGYWKATGK DRQVFSASTG  120
ALLGMKKTLV FYKGRAPRGH KTKWVMHEYR LDGHFSSYRH DCQVWTHNPY LHPCTCTPMA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-482315114140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981210.0KF198121.1 Malus hupehensis NAC domain protein (NAC80) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008346452.11e-136PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
SwissprotQ9S8514e-84NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLR4N7J52e-98R4N7J5_JATCU; NAC transcription factor 007
STRINGPOPTR_0002s00730.11e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF78883347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.12e-85NAC family protein